SOGA1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16597
Zusätzliche Namen:: C20orf117|KIAA0889|SOGA|SOGA1
Anwendung:: ELISA, WB
Molekulargewicht:: 80kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: AEVLPGLREQAALVSKAIDVLVADANGFTAGLRLCLDNECADFRLHEAPDNSEGPRDTKLIHAILVRLSVLQQELNAFTRKADAVLGCSVKEQQESFSSLP
Uniprot:: O94964
Synonyme:: C20orf117;KIAA0889;protein SOGA1;SOGA;SOGA family member 1;suppressor of glucose by autophagy;suppressor of glucose from autophagy;suppressor of glucose, autophagy-associated protein 1
Weitere Details:: Predicted to be involved in insulin receptor signaling pathway; negative regulation of gluconeogenesis; and regulation of autophagy. Located in extracellular space.