A16594
NRN1L Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A16594
- Zusätzliche Namen:
- cpg15-2|MRCC2446|NRN1L|UNQ2446
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 18kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- PNRCDTIYQGFAECLIRLGDSMGRGGELETICRSWNDFHACASQVLSGCPEEAAAVWESLQQEARQAPRPNNLHTLCGAPVHVRERGTGSETNQETLRATA
- Uniprot:
- Q496H8
- Synonyme:
- cpg15-2;MRCC2446;neuritin-like protein;UNQ2446
- Weitere Details:
- The protein encoded by this gene is extracellular and enhances both neurite growth and neuronal survival. The encoded protein is found both as a GPI anchored membrane-bound form and as a secreted form. This activity-related ligand functions as a homodimer or heterodimer.
- Versandbedingungen:
- Blue Ice