PTPN5 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16585
Zusätzliche Namen:: PTPN5|PTPSTEP|STEP|STEP61
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 46kDa/61kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SFTYSEWMEEKIEDDFLDLDPVPETPVFDCVMDIKPEADPTSLTVKSMGLQERRGSNVSLTLDMCTPGCNEEGFGYLMSPREESAREYLLSASRVLQAEELHEKALDPFLLQAEFFEI
Uniprot:: P54829
Synonyme:: neural-specific protein-tyrosine phosphatase;protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched);protein-tyrosine phosphatase striatum-enriched;PTPSTEP;STEP;STEP61;striatal-enriched protein tyrosine phosphatase;striatum-enriched protein-tyrosine phosphatase;tyrosine-protein phosphatase non-receptor type 5
Weitere Details:: Enables phosphotyrosine residue binding activity. Predicted to be involved in peptidyl-tyrosine dephosphorylation. Predicted to act upstream of or within protein dephosphorylation. Predicted to be located in nucleoplasm. Predicted to be integral component of membrane. Biomarker of Alzheimer's disease.