STARD3NL Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16579
Zusätzliche Namen:: MENTHO|STARD3NL
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 26kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: RLLIVQDASERAALIPGGLSDGQFYSPPESEAGSEEAEEKQDSEKPLLEL
Uniprot:: O95772
Synonyme:: MENTHO;MLN64 N-terminal domain homolog;STARD3 N-terminal-like protein
Weitere Details:: This gene encodes a late-endosomal protein that contains a conserved MENTAL (MLN64 N-terminal) domain. The encoded protein binds cholesterol molecules and may play a role in endosomal cholesterol transport through interactions with metastatic lymph node protein 64 (MLN64).