ZCCHC10 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16539
Zusätzliche Namen:: ZCCHC10
Anwendung:: ELISA
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MATPMHRLIARRQAFDTELQPVKTFWILIQPSIVISEANKQHVRCQKCLEFGHWTYECTGKRKYLHRPSRTAELKKALKEKENRLLLQQSIGETNVERKA
Uniprot:: Q8TBK6
Synonyme:: zinc finger CCHC domain-containing protein 10;zinc finger, CCHC domain containing 10
Weitere Details:: Predicted to enable nucleic acid binding activity and zinc ion binding activity.