A16510
DCAF12 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A16510
- Zusätzliche Namen:
- CT102|DCAF12|KIAA1892|TCC52|WDR40A
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 47kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MARKVVSRKRKAPASPGAGSDAQGPQFGWDHSLHKRKRLPPVKRSLVYYLKNREVRLQNETSYSRVLHGYAAQQLPSLLKEREFH
- Uniprot:
- Q5T6F0
- Synonyme:
- cancer/testis antigen 102;centrosome-related protein TCC52;CT102;DDB1- and CUL4-associated factor 12;KIAA1892;TCC52;testis cancer centrosome-related protein;WD repeat domain 40A;WD repeat-containing protein 40A;WDR40A
- Weitere Details:
- This gene encodes a WD repeat-containing protein that interacts with the COP9 signalosome, a macromolecular complex that interacts with cullin-RING E3 ligases and regulates their activity by hydrolyzing cullin-Nedd8 conjugates.
- Versandbedingungen:
- Blue Ice

