PARP2 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A16475
Zusätzliche Namen:: ADPRT2|ADPRTL2|ADPRTL3|ARTD2|pADPRT-2|PARP-2|PARP2
Anwendung:: ELISA, WB
Molekulargewicht:: 66kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: FADMSSKSANYCFASRLKNTGLLLLSEVALGQCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTLNGSTVPLGPASDTGILNPDGYTLNYNEYIVYN
Uniprot:: Q9UGN5
Synonyme:: ADP-ribosyltransferase (NAD+; poly(ADP-ribose) polymerase)-like 2;ADP-ribosyltransferase diphtheria toxin-like 2;ADPRT-2;ADPRT2;ADPRTL2;ADPRTL3;ARTD2;DNA ADP-ribosyltransferase PARP2;hPARP-2;NAD(+) ADP-ribosyltransferase 2;pADPRT-2;PARP-2;poly (ADP-ribose) polymerase family, member 2;poly (ADP-ribosyl) transferase-like 2;poly [ADP-ribose] polymerase 2;poly[ADP-ribose] synthase 2;poly[ADP-ribose] synthetase 2;protein poly-ADP-ribosyltransferase PARP2
Weitere Details:: This gene encodes poly(ADP-ribosyl)transferase-like 2 protein, which contains a catalytic domain and is capable of catalyzing a poly(ADP-ribosyl)ation reaction. This protein has a catalytic domain which is homologous to that of poly (ADP-ribosyl) transferase, but lacks an N-terminal DNA binding domain which activates the C-terminal catalytic domain of poly (ADP-ribosyl) transferase. The basic residues within the N-terminal region of this protein may bear potential DNA-binding properties, and may be involved in the nuclear and/or nucleolar targeting of the protein. Two alternatively spliced transcript variants encoding distinct isoforms have been found.

Versandbedingungen:: Blue Ice