UBE2E2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16441
Zusätzliche Namen:: UBCH8|UBE2E2
Anwendung:: ELISA, WB
Molekulargewicht:: 22kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT
Uniprot:: Q96LR5
Synonyme:: E2 ubiquitin-conjugating enzyme E2;UBCH8;ubiquitin carrier protein E2;ubiquitin conjugating enzyme E2E 2;ubiquitin-conjugating enzyme E2 E2;ubiquitin-conjugating enzyme E2E 2 (homologous to yeast UBC4/5);ubiquitin-conjugating enzyme E2E 2 (UBC4/5 homolog, yeast);ubiquitin-protein ligase E2
Weitere Details:: Enables ISG15 transferase activity and ubiquitin conjugating enzyme activity. Involved in protein modification by small protein conjugation. Acts upstream of or within cellular response to DNA damage stimulus and positive regulation of G1/S transition of mitotic cell cycle. Predicted to be active in nucleus.