SCD1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16429
Zusätzliche Namen:: FADS5|hSCD1|MSTP008|SCD|SCD1|SCDOS
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 37 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEYVWRNIILMSLLHLGALYGITLIPTCKFYT
Uniprot:: O00767
Synonyme:: acyl-CoA desaturase;delta(9)-desaturase;FADS5;fatty acid desaturase;hSCD1;MSTP008;predicted protein of HQ0998;SCD1;SCDOS;stearoyl-CoA desaturase;stearoyl-CoA desaturase (delta-9-desaturase);stearoyl-CoA desaturase opposite strand
Weitere Details:: This gene encodes an enzyme involved in fatty acid biosynthesis, primarily the synthesis of oleic acid. The protein belongs to the fatty acid desaturase family and is an integral membrane protein located in the endoplasmic reticulum. Transcripts of approximately 3.9 and 5.2 kb, differing only by alternative polyadenlyation signals, have been detected. A gene encoding a similar enzyme is located on chromosome 4 and a pseudogene of this gene is located on chromosome 17.