D Delta-Catenin/p120 Catenin Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1641
Zusätzliche Namen:: BCDS2|CAS|CTNND|p120|p120(CAS)|p120(CTN)|P120CAS|P120CTN|D Delta-Catenin/p120 Catenin
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 101kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNRTLDRSGDLGDMEPLKGTTPLMQDEGQESLEEELDVLVLDDEGGQVSYPSMQKI
Uniprot:: O60716
Synonyme:: BCDS2;cadherin-associated Src substrate;CAS;catenin (cadherin-associated protein), delta 1;catenin delta-1;CTNND;p120;p120 catenin;p120(CAS);p120(CTN);P120CAS;P120CTN
Weitere Details:: This gene encodes a member of the Armadillo protein family, which function in adhesion between cells and signal transduction. Multiple translation initiation codons and alternative splicing result in many different isoforms being translated. Not all of the full-length natures of the described transcript variants have been determined. Read-through transcription also exists between this gene and the neighboring upstream thioredoxin-related transmembrane protein 2 (TMX2) gene.