Slc31a2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16362
Zusätzliche Namen:: CTR2|Slc31a2
Anwendung:: ELISA, WB
Molekulargewicht:: 16kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MHFIFSDEAVLLFDFWRVHSPTGMALSVLVVLLLAVLYEGIKVGKAKLLHKTLESLPATNSQQFILGPDQDSTGSRSTSDNRTRLRWFLCYFGQSLVHVI
Uniprot:: O15432
Synonyme:: AI604396;copper transporter 2;COPT2;Ctr;CTR2;hCTR2;probable low affinity copper uptake protein 2;solute carrier family 31 (copper transporter), member 2;solute carrier family 31 (copper transporters), member 2;Solute carrier family 31 member 2
Weitere Details:: Acts upstream of or within cellular copper ion homeostasis and regulation of copper ion transmembrane transport. Located in late endosome; membrane; and recycling endosome. Is expressed in brain; retina nuclear layer; and urinary system. Orthologous to human SLC31A2 (solute carrier family 31 member 2).