BOK Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16354
Zusätzliche Namen:: BCL2L9|BOK|BOKL
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 23 kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERAAPVPGRLAEVCAVLLRLGDELEMIRPSVYRNVARQLHISLQSEP
Uniprot:: Q9UMX3
Synonyme:: bcl-2-like protein 9;bcl-2-related ovarian killer protein;BCL2 related ovarian killer;bcl2-L-9;BCL2L9;BOK, BCL2 family apoptosis regulator;BOKL;hBOK
Weitere Details:: The protein encoded by this gene belongs to the BCL2 family, members of which form homo- or heterodimers, and act as anti- or proapoptotic regulators that are involved in a wide variety of cellular processes. Studies in rat show that this protein has restricted expression in reproductive tissues, interacts strongly with some antiapoptotic BCL2 proteins, not at all with proapoptotic BCL2 proteins, and induces apoptosis in transfected cells. Thus, this protein represents a proapoptotic member of the BCL2 family.