A16323
SON Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A16323
- Zusätzliche Namen:
- BASS1|C21orf50|DBP-5|NREBP|SON|SON3|TOKIMS
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 250kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequenz:
- TMDSQMLATSSMDSQMLASGTMDSQMLASGTMDAQMLASGTMDAQMLASSTQDSAMLGSKSPDPYRLAQDPYRLAQDPYRLGHDPYRLGHDAYRLGQDPYR
- Uniprot:
- P18583
- Synonyme:
- BASS1;Bax antagonist selected in Saccharomyces 1;C21orf50;DBP-5;negative regulatory element-binding protein;NRE-binding protein;NREBP;Protein DBP-5;protein SON;SON DNA binding protein;SON3;TOKIMS
- Weitere Details:
- This gene encodes a protein that contains multiple simple repeats. The encoded protein binds RNA and promotes pre-mRNA splicing, particularly of transcripts with poor splice sites. The protein also recognizes a specific DNA sequence found in the human hepatitis B virus (HBV) and represses HBV core promoter activity. There is a pseudogene for this gene on chromosome 1. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice