TERF2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16316
Zusätzliche Namen:: TERF2|TRBF2|TRF2
Anwendung:: ELISA, WB
Molekulargewicht:: 70kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KEAAVIICIKNKEFEKASKILKKHMSKDPTTQKLRNDLLNIIREKNLAHPVIQNFSYETFQQKMLRFLESHLDDAEPYLLTMAKKALKSESAASSTGKEDK
Uniprot:: Q15554
Synonyme:: telomeric DNA-binding protein;telomeric repeat binding protein 2;telomeric repeat-binding factor 2;TRBF2;TRF2;TTAGGG repeat-binding factor 2
Weitere Details:: This gene encodes a telomere specific protein, TERF2, which is a component of the telomere nucleoprotein complex. This protein is present at telomeres in metaphase of the cell cycle, is a second negative regulator of telomere length and plays a key role in the protective activity of telomeres. While having similar telomere binding activity and domain organization, TERF2 differs from TERF1 in that its N terminus is basic rather than acidic.