RPS6KA2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16305
Zusätzliche Namen:: HU-2|MAPKAPK1C|p90-RSK3|p90RSK2|pp90RSK3|RPS6KA2|RSK|RSK3|S6K-alpha|S6K-alpha2
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 83kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: ALSGGNWDSISDAAKDVVSKMLHVDPHQRLTAMQVLKHPWVVNREYLSPNQLSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTRL
Uniprot:: Q15349
Synonyme:: 90 kDa ribosomal protein S6 kinase 2;HU-2;MAP kinase-activated protein kinase 1c;MAPK-activated protein kinase 1c;MAPKAPK1C;mitogen-activated protein kinase-activated protein kinase 1C;p90-RSK3;p90RSK2;pp90RSK3;ribosomal protein S6 kinase alpha-2;ribosomal protein S6 kinase, 90kDa, polypeptide 2;ribosomal S6 kinase 3;RSK;RSK3;S6K-alpha;S6K-alpha2
Weitere Details:: This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains two non-identical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Alternative splice variants, encoding different isoforms, have been characterized.