A16301
L-Myc Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A16301
- Zusätzliche Namen:
- bHLHe38|L-Myc|LMYC|MYCL|MYCL1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 40kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- EDEEIVSPPPVESEAAQSCHPKPVSSDTEDVTKRKNHNFLERKRRNDLRSRFLALRDQVPTLASCSKAPKVVILSKALEYLQALVGAEKRMATEKRQLRCRQQQLQKRIAYLTGY
- Uniprot:
- P12524
- Synonyme:
- bHLHe38;class E basic helix-loop-helix protein 38;L-Myc;l-myc-1 proto-oncogene;LMYC;myc-related gene from lung cancer;MYCL1;protein L-Myc;protein L-Myc-1;v-myc avian myelocytomatosis viral oncogene lung carcinoma derived homolog;V-myc myelocytomatosis viral oncogene homolog;v-myc myelocytomatosis viral oncogene homolog 1, lung carcinoma derived
- Weitere Details:
- Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to act upstream of or within regulation of inner ear auditory receptor cell differentiation. Located in chromosome and nucleoplasm.
- Versandbedingungen:
- Blue Ice

