SRA1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16296
Zusätzliche Namen:: pp7684|SRA|SRA1|SRAP|STRAA1
Anwendung:: ELISA, WB
Molekulargewicht:: 26kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Sequenz:: MTRCPAGQAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQAGGPRRSLLTKRVAAPQDGSPRVPASETSPGPPPMGPPPPSSKAPRSPPVGSGPASGVEP
Uniprot:: Q9HD15
Synonyme:: pp7684;SRA;SRAP;steroid receptor coactivator;steroid receptor RNA activator 1;steroid receptor RNA activator 1 (complexes with NCOA1);steroid receptor RNA activator protein;STRAA1
Weitere Details:: Both long non-coding and protein-coding RNAs are transcribed from this gene, and they represent alternatively spliced transcript variants. This gene was initially defined as a non-coding RNA, which is a coactivator for several nuclear receptors (NRs) and is associated with breast cancer. It has now been found that this gene is involved in the regulation of many NR and non-NR activities, including metabolism, adipogenesis and chromatin organization. The long non-coding RNA transcripts interact with a variety of proteins, including the protein encoded by this gene. The encoded protein acts as a transcriptional repressor by binding to the non-coding RNA.