A16274
WASF3 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A16274
- Zusätzliche Namen:
- Brush-1|SCAR3|WASF3|WAVE3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 55kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequenz:
- RTRKEEWERRKMGIEFMSDAKKLEQAGSAKEDRVPSGSHASDVTDYSYPATPNHSLHPQPVTPSYAAGDVPPHGPASQAAEHEYRPPSASARHMALNRPQQ
- Uniprot:
- Q9UPY6
- Synonyme:
- Brush-1;protein WAVE-3;SCAR3;verprolin homology domain-containing protein 3;WAS protein family member 3;WASP family Verprolin-homologous protein 3;WAVE3;wiskott-Aldrich syndrome protein family member 3
- Weitere Details:
- This gene encodes a member of the Wiskott-Aldrich syndrome protein family. The gene product is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function. A pseudogene of this gene have been defined on chromosome 6. Alternative splicing results in multiple transcript variants
- Versandbedingungen:
- Blue Ice