ACSL1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16253
Zusätzliche Namen:: ACS1|ACSL1|FACL1|FACL2|LACS|LACS1|LACS2
Anwendung:: ELISA, WB, IF, ICC, IP
Molekulargewicht:: 78 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: This information is considered to be commercially sensitive.
Sequenz:: TRPKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQKGFKTA
Uniprot:: P33121
Synonyme:: ACS1;acyl-CoA synthetase 1;arachidonate--CoA ligase;FACL1;FACL2;fatty-acid-Coenzyme A ligase, long-chain 1;fatty-acid-Coenzyme A ligase, long-chain 2;LACS;LACS 1;LACS 2;LACS1;LACS2;lignoceroyl-CoA synthase;long-chain acyl-CoA synthetase 1;long-chain acyl-CoA synthetase 2;long-chain fatty acid-CoA ligase 2;long-chain fatty-acid-coenzyme A ligase 1;long-chain-fatty-acid--CoA ligase 1;palmitoyl-CoA ligase 1;palmitoyl-CoA ligase 2;paltimoyl-CoA ligase 1;phytanate--CoA ligase
Weitere Details:: The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. Several transcript variants encoding different isoforms have been found for this gene.

Versandbedingungen:: Blue Ice