COX6C Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16250
Zusätzliche Namen:: COX6C
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: Refer to figures
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Sequenz:: MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK
Uniprot:: P09669
Synonyme:: cytochrome c oxidase polypeptide VIc;cytochrome c oxidase subunit 6C;cytochrome c oxidase subunit VIc preprotein;epididymis secretory sperm binding protein
Weitere Details:: Cytochrome c oxidase, the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIc, which has 77% amino acid sequence identity with mouse subunit VIc. This gene is up-regulated in prostate cancer cells. A pseudogene has been found on chromosomes 16p12.