LATS2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16249
Zusätzliche Namen:: KPM|LATS2
Anwendung:: ELISA, WB
Molekulargewicht:: 150 kDa(N terminal protein)
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: FGPYQKALREIRYSLLPFANESGTSAAAEVNRQMLQELVNAGCDQEMAGRALKQTGSRSIEAALEYISKMGYLDPR
Uniprot:: Q9NRM7
Synonyme:: kinase phosphorylated during mitosis protein;KPM;large tumor suppressor homolog 2;LATS (large tumor suppressor, Drosophila) homolog 2;LATS, large tumor suppressor, homolog 2;serine/threonine kinase KPM;serine/threonine-protein kinase kpm;serine/threonine-protein kinase LATS2;warts-like kinase
Weitere Details:: This gene encodes a serine/threonine protein kinase belonging to the LATS tumor suppressor family. The protein localizes to centrosomes during interphase, and early and late metaphase. It interacts with the centrosomal proteins aurora-A and ajuba and is required for accumulation of gamma-tubulin and spindle formation at the onset of mitosis. It also interacts with a negative regulator of p53 and may function in a positive feedback loop with p53 that responds to cytoskeleton damage. Additionally, it can function as a co-repressor of androgen-responsive gene expression.