A16242
MAP3K11 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A16242
- Zusätzliche Namen:
- MAP3K11|MEKK11|MLK-3|MLK3|PTK1|SPRK
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 93kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequenz:
- LVAVKAARQDPDEDISVTAESVRQEARLFAMLAHPNIIALKAVCLEEPNLCLVMEYAAGGPLSRALAGRRVPPHVLVNWAVQIARGMHYLHCEALVPVIHRDLKSNNILLLQPIESDDMEH
- Uniprot:
- Q16584
- Synonyme:
- MEKK11;mitogen-activated protein kinase kinase kinase 11;mixed lineage kinase 3;MLK-3;MLK3;protein-tyrosine kinase PTK1;PTK1;SH3 domain-containing proline-rich kinase;SPRK;src-homology 3 domain-containing proline-rich kinase
- Weitere Details:
- The protein encoded by this gene is a member of the serine/threonine kinase family. This kinase contains a SH3 domain and a leucine zipper-basic motif. This kinase preferentially activates MAPK8/JNK kinase, and functions as a positive regulator of JNK signaling pathway. This kinase can directly phosphorylate, and activates IkappaB kinase alpha and beta, and is found to be involved in the transcription activity of NF-kappaB mediated by Rho family GTPases and CDC42.
- Versandbedingungen:
- Blue Ice