GGPS1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16233
Zusätzliche Namen:: GGPPS|GGPPS1|GGPS1|MDHLO|MUDHLOV
Anwendung:: ELISA, WB
Molekulargewicht:: 35kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QLFSDYKEDLKPLLNTLGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSRPESTQVQNILRQRTENIDIKKYCVHYLEDVGSFEYTRNTLKELEAKAYKQIDARGGNPELVALVKHLSKMFKEENE
Uniprot:: O95749
Synonyme:: (2E,6E)-farnesyl diphosphate synthase;dimethylallyltranstransferase;farnesyl diphosphate synthase;farnesyltranstransferase;Geranylgeranyl diphosphate synthase;geranylgeranyl pyrophosphate synthase;geranyltranstransferase;GGPP synthase;GGPPS;GGPPS1;GGPPSase;MDHLO;MUDHLOV
Weitere Details:: This gene is a member of the prenyltransferase family and encodes a protein with geranylgeranyl diphosphate (GGPP) synthase activity. The enzyme catalyzes the synthesis of GGPP from farnesyl diphosphate and isopentenyl diphosphate. GGPP is an important molecule responsible for the C20-prenylation of proteins and for the regulation of a nuclear hormone receptor. Alternate transcriptional splice variants, both protein-coding and non-protein-coding, have been found for this gene.