A16229
ID4 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A16229
- Zusätzliche Namen:
- bHLHb27|ID4|IDB4
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 20kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequenz:
- MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDY
- Uniprot:
- P47928
- Synonyme:
- bHLHb27;class B basic helix-loop-helix protein 27;DNA-binding protein inhibitor ID-4;IDB4;inhibitor of differentiation 4;Inhibitor of DNA binding 4;inhibitor of DNA binding 4, dominant negative helix-loop-helix protein
- Weitere Details:
- This gene encodes a member of the inhibitor of DNA binding (ID) protein family. The encoded protein lacks DNA binding ability, and instead regulates gene expression through binding to and inhibiting basic helix-loop-helix transcription factors. This protein has been implicated in the regulation of diverse cellular processes that play a role in development and tumorigenesis.
- Versandbedingungen:
- Blue Ice