Casein Kinase 1 alpha (CSNK1A1) Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16225
Zusätzliche Namen:: Casein Kinase 1 alpha (CSNK1A1)|CK1|CK1a|CKIa|HEL-S-77p|HLCDGP1|PRO2975
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 38kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF
Uniprot:: P48729
Synonyme:: casein kinase I isoform alpha;CK1;CK1a;CKI-alpha;CKIa;clock regulator kinase;down-regulated in lung cancer;epididymis secretory sperm binding protein Li 77p;HEL-S-77p;HLCDGP1;PRO2975
Weitere Details:: Enables protein serine/threonine kinase activity. Involved in several processes, including negative regulation of canonical Wnt signaling pathway; peptidyl-serine phosphorylation; and positive regulation of proteasomal ubiquitin-dependent protein catabolic process. Located in centrosome; cytosol; and nuclear speck. Part of beta-catenin destruction complex. Colocalizes with keratin filament and mRNA cleavage and polyadenylation specificity factor complex. Biomarker of Alzheimer's disease and inclusion body myositis.