IBSP Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16220
Zusätzliche Namen:: BNSP|BSP|BSP-II|IBSP|SP-II
Anwendung:: ELISA, WB
Molekulargewicht:: 35kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MKTALILLSILGMACAFSMKNLHRRVKIEDSEENGVFKYRPRYYLYKHAYFYPHLKRFPVQGSSDSSEENGDDSSEEEEEEEETSNEGENNEESNEDEDS
Uniprot:: P21815
Synonyme:: BNSP;bone sialoprotein 2;bone sialoprotein II;BSP;BSP II;BSP-II;cell-binding sialoprotein;Integrin-binding sialoprotein;SP-II
Weitere Details:: The protein encoded by this gene is a major structural protein of the bone matrix. It constitutes approximately 12% of the noncollagenous proteins in human bone and is synthesized by skeletal-associated cell types, including hypertrophic chondrocytes, osteoblasts, osteocytes, and osteoclasts. The only extraskeletal site of its synthesis is the trophoblast. This protein binds to calcium and hydroxyapatite via its acidic amino acid clusters, and mediates cell attachment through an RGD sequence that recognizes the vitronectin receptor.