A1621
FABPI Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A1621
- Zusätzliche Namen:
- FABPI|I-FABP
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 15kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSTFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD
- Uniprot:
- P12104
- Synonyme:
- FABPI;fatty acid binding protein 2, intestinal;Fatty acid-binding protein 2;fatty acid-binding protein, intestinal;I-FABP;intestinal-type fatty acid-binding protein
- Weitere Details:
- The protein encoded by this gene is an intracellular fatty acid-binding protein that participates in the uptake, intracellular metabolism, and transport of long-chain fatty acids. The encoded protein is also involved in the modulation of cell growth and proliferation. This protein binds saturated long-chain fatty acids with high affinity, and may act as a lipid sensor to maintain energy homeostasis.
- Versandbedingungen:
- Blue Ice