A16207
CXCL6 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A16207
- Zusätzliche Namen:
- CKA-3|CXCL6|GCP-2|GCP2|SCYB6
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 17kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequenz:
- GPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
- Uniprot:
- P80162
- Synonyme:
- C-X-C motif chemokine 6;chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2);chemokine alpha 3;CKA-3;GCP-2;GCP2;granulocyte chemotactic protein 2;SCYB6;small inducible cytokine subfamily B (Cys-X-Cys), member 6 (granulocyte chemotactic protein 2);small inducible cytokine subfamily B (Cys-X-Cys), member b;small-inducible cytokine B6
- Weitere Details:
- The protein encoded by this gene is a member CXC chemokine family. The encoded protein is a chemotactic for neutrophil granulocytes and has antibacterial action against gram-negative and gram-positive bacteria. This gene and other members of the CXC chemokine gene family form a gene cluster in a region of chromosome 4q.
- Versandbedingungen:
- Blue Ice