SLC6A9 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16203
Zusätzliche Namen:: GCENSG|GLYT1|SLC6A9
Anwendung:: ELISA, WB
Molekulargewicht:: 75kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: MSGGDTRAAIARPRMAAAHGPVAPSSPEQVTLLPVQRSFFLPPFSGATPSTSLAESVLKVWHGAYNSGLLPQLMAQHSLAMAQNGAVPSEATKRDQNLKRGNWGNQIEFV
Uniprot:: P48067
Synonyme:: GCENSG;glyT-1;GLYT1;sodium- and chloride-dependent glycine transporter 1;solute carrier family 6 (neurotransmitter transporter, glycine), member 9;Solute carrier family 6 member 9
Weitere Details:: The amino acid glycine acts as an inhibitory neurotransmitter in the central nervous system. The protein encoded by this gene is one of two transporters that stop glycine signaling by removing it from the synaptic cleft.