SERPINA9 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16182
Zusätzliche Namen:: GCET1|SERPINA11|SERPINA11b|SERPINA9
Anwendung:: ELISA, WB
Molekulargewicht:: 46kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TQILQGLGFNLTHTPESAIHQGFQHLVHSLTVPSKDLTLKMGSALFVKKELQLQANFLGNVKRLYEAEVFSTDFSNPSIAQARINSHVKKKTQGKVVDIIQ
Uniprot:: Q86WD7
Synonyme:: centerin;GCET1;germinal center B-cell-expressed transcript 1 protein;serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 9;serine proteinase inhibitor A11;serpin A9;serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 9;SERPINA11;SERPINA11b
Weitere Details:: Enables serine-type endopeptidase inhibitor activity. Predicted to be involved in negative regulation of endopeptidase activity. Predicted to be located in cytoplasm and membrane. Predicted to be active in extracellular space.