SLC34A3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16168
Zusätzliche Namen:: HHRH|NPT2C|NPTIIc|SLC34A3
Anwendung:: ELISA, WB
Molekulargewicht:: 63kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MPSSLPGSQVPHPTLDAVDLVEKTLRNEGTSSSAPVLEEGDTDPWTLPQLKDTSQPWKELRVAGRLRRVAGSVLKACGLLGSLYFFICSLDVLSSAFQLLGSKVAGDIFKDNVVLSN
Uniprot:: Q8N130
Synonyme:: HHRH;Na(+)-dependent phosphate cotransporter 2C;Na(+)/Pi cotransporter 2C;naPi-2c;NPTIIc;sodium-dependent phosphate transport protein 2C;sodium-phosphate transport protein 2C;sodium/inorganic phosphate cotransporter IIC;Sodium/phosphate cotransporter 2C;solute carrier family 34 (sodium phosphate), member 3;solute carrier family 34 (type II sodium/phosphate cotransporter), member 3;Solute carrier family 34 member 3;type IIc Na+/Pi cotransporter
Weitere Details:: This gene encodes a member of SLC34A transporter family of proteins, and is expressed primarily in the kidney. It is involved in transporting phosphate into cells via sodium cotransport in the renal brush border membrane, and contributes to the maintenance of inorganic phosphate concentration in the kidney. Mutations in this gene are associated with hereditary hypophosphatemic rickets with hypercalciuria. Alternatively spliced transcript variants varying in the 5' UTR have been found for this gene.

Versandbedingungen:: Blue Ice