A16168
SLC34A3 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A16168
- Zusätzliche Namen:
- HHRH|NPT2C|NPTIIc|SLC34A3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 63kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MPSSLPGSQVPHPTLDAVDLVEKTLRNEGTSSSAPVLEEGDTDPWTLPQLKDTSQPWKELRVAGRLRRVAGSVLKACGLLGSLYFFICSLDVLSSAFQLLGSKVAGDIFKDNVVLSN
- Uniprot:
- Q8N130
- Synonyme:
- HHRH;Na(+)-dependent phosphate cotransporter 2C;Na(+)/Pi cotransporter 2C;naPi-2c;NPTIIc;sodium-dependent phosphate transport protein 2C;sodium-phosphate transport protein 2C;sodium/inorganic phosphate cotransporter IIC;Sodium/phosphate cotransporter 2C;solute carrier family 34 (sodium phosphate), member 3;solute carrier family 34 (type II sodium/phosphate cotransporter), member 3;Solute carrier family 34 member 3;type IIc Na+/Pi cotransporter
- Weitere Details:
- This gene encodes a member of SLC34A transporter family of proteins, and is expressed primarily in the kidney. It is involved in transporting phosphate into cells via sodium cotransport in the renal brush border membrane, and contributes to the maintenance of inorganic phosphate concentration in the kidney. Mutations in this gene are associated with hereditary hypophosphatemic rickets with hypercalciuria. Alternatively spliced transcript variants varying in the 5' UTR have been found for this gene.
- Versandbedingungen:
- Blue Ice

