TMEM132D Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16164
Zusätzliche Namen:: MOLT|PPP1R153|TMEM132D
Anwendung:: ELISA, WB
Molekulargewicht:: 122kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: DFSLMATSLDEKVVSIHQDPKFKWPIIAAETEGQGTLVKVEMVISESCQKSKRKSVLAVGTANIKVKFGQNDANPNTSDSRHTGAGVHMENNVSDRRPKKPSQEWGSQEGQYYGSSSMGLMEGRGTTTDRSILQKKKGQESLLDDNSHLQTIPSDLTSFPAQVDLPRSNGEMDGNDLMQASKGLSD
Uniprot:: Q14C87
Synonyme:: mature OL transmembrane protein;mature oligodendrocytes transmembrane protein;MOLT;PPP1R153;protein phosphatase 1, regulatory subunit 153;transmembrane protein 132D
Weitere Details:: May serve as a cell-surface marker for oligodendrocyte differentiation.