A16158
RNF185 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A16158
- Zusätzliche Namen:
- RNF185
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 20kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MASKGPSASASPENSSAGGPSGSSNGAGESGGQDSTFECNICLDTAKDAVISLCGHLFCWPCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGFQGFGFGD
- Uniprot:
- Q96GF1
- Synonyme:
- BSK65-MONO1;BSK65-MONO2;BSK65-PANC1;BSK65-PANC2;BSK65-TEST1;BSK65-TEST2;BSK65-TEST3;E3 ubiquitin-protein ligase RNF185;RING finger protein 185;RING-type E3 ubiquitin transferase RNF185
- Weitere Details:
- Enables ubiquitin binding activity; ubiquitin protein ligase activity; and ubiquitin-like protein conjugating enzyme binding activity. Involved in positive regulation of ERAD pathway; protein autoubiquitination; and ubiquitin-dependent ERAD pathway. Located in endoplasmic reticulum.
- Versandbedingungen:
- Blue Ice

