A16111
COG4 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A16111
- Zusätzliche Namen:
- CDG2J|COD1|COG4|SWILS
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 100kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LQVECDRQVEKVVDKFIKQRDYHQQFRHVQNNLMRNSTTEKIEPRELDPILTEVTLMNARSELYLRFLKKRISSDFEVGDSMASEEVKQEHQKCLDKLLNN
- Uniprot:
- Q9H9E3
- Synonyme:
- CDG2J;COD1;COG complex subunit 4;complexed with Dor1p;Component of oligomeric Golgi complex 4;conserved oligomeric Golgi complex protein 4;conserved oligomeric Golgi complex subunit 4;SWILS
- Weitere Details:
- The protein encoded by this gene is a component of an oligomeric protein complex involved in the structure and function of the Golgi apparatus. Defects in this gene may be a cause of congenital disorder of glycosylation type IIj. Two transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice