A16109
CDK19 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A16109
- Zusätzliche Namen:
- bA346C16.3|CDC2L6|CDK11|CDK19|DEE87|EIEE87
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 57kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- QQQNQHQQPTAPPQQAAAPPQAPPPQQNSTQTNGTAGGAGAGVGGTGAGLQHSQDSSLNQVPPNKKPRLGPSGANSGGPVMPSDYQHSSSRLNYQSSVQGS
- Uniprot:
- Q9BWU1
- Synonyme:
- bA346C16.3;CDC2-related protein kinase 6;CDC2L6;CDK11;CDK8-like cyclin-dependent kinase;cell division cycle 2-like 6 (CDK8-like);cell division cycle 2-like protein kinase 6;cell division protein kinase 19;cyclin dependent kinase 19 variant 2;cyclin-dependent kinase (CDC2-like) 11;cyclin-dependent kinase 11;cyclin-dependent kinase 19;death-preventing kinase;DEE87;EIEE87
- Weitere Details:
- This gene encodes a protein that is one of the components of the Mediator co-activator complex. The Mediator complex is a multi-protein complex required for transcriptional activation by DNA binding transcription factors of genes transcribed by RNA polymerase II. The protein encoded by this gene is similar to cyclin-dependent kinase 8 which can also be a component of the Mediator complex. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
- Versandbedingungen:
- Blue Ice