A16095
DENND4A Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A16095
- Zusätzliche Namen:
- DENND4A|IRLB|MYCPBP
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 209kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- RPGRYFLKSSPSTENMHFPSSISSQTRQSCISTSASGLDTSALSVQGNFDLNSKSKLQENFCTRSIQIPANRSKTAMSKCPIFPMARSISTSGPLDKEDTGRQKLISTGSLPATLQGATDSLGLEWHLPSPDPVTVPYLSPLVVWKELESL
- Uniprot:
- Q7Z401
- Synonyme:
- c-myc promoter binding protein;C-myc promoter-binding protein;DENN domain-containing protein 4A;DENN/MADD domain containing 4A;IRLB;MYCPBP
- Weitere Details:
- This gene encodes a DENN domain-containing protein that may function as a guanine nucleotide exchange factor that specifically activates ras-related protein Rab-10. This protein also contains a interferon stimulated response element-binding domain and may be involved in regulating the v-myc avian myelocytomatosis viral (MYC) oncogene. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 8.
- Versandbedingungen:
- Blue Ice

