A1609
NPPA Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A1609
- Zusätzliche Namen:
- ANF|ANP|ATFB6|ATRST2|CDD|CDD-ANF|CDP|NPPA|PND
- Anwendung:
- ELISA, WB, IF
- Molekulargewicht:
- 17 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LTWQEIMSITELQGLNAPSEPSFEPQAPAPYLGPPPPTTYCPCSIHPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQDPLALLDIGLPAGPPKPQEDPESDSGLSLN
- Uniprot:
- P01160
- Synonyme:
- ANF;ANP;ATFB6;atrial natriuretic factor prohormone;atrial natriuretic peptide prohormone;atriopeptigen;atriopeptin;ATRST2;Cardiodilatin;cardiodilatin-related peptide;cardionatrin;CDD;CDD-ANF;CDP;natriuretic peptide precursor A variant 1;natriuretic peptides A;PND;preproANP;preproCDD-ANF;prepronatriodilatin;proANF;proANP
- Weitere Details:
- The protein encoded by this gene belongs to the natriuretic peptide family. Natriuretic peptides are implicated in the control of extracellular fluid volume and electrolyte homeostasis. This protein is synthesized as a large precursor (containing a signal peptide), which is processed to release a peptide from the N-terminus with similarity to vasoactive peptide, cardiodilatin, and another peptide from the C-terminus with natriuretic-diuretic activity. Mutations in this gene have been associated with atrial fibrillation familial type 6. This gene is located adjacent to another member of the natriuretic family of peptides on chromosome 1.
- Versandbedingungen:
- Blue Ice



