MED7 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16088
Zusätzliche Namen:: ARC34|CRSP33|CRSP9|MED7
Anwendung:: ELISA, WB
Molekulargewicht:: 27kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIEKDAALCVLIDEMNERP
Uniprot:: O43513
Synonyme:: activator-recruited cofactor 34 kDa component;ARC34;cofactor required for Sp1 transcriptional activation subunit 9;cofactor required for Sp1 transcriptional activation, subunit 9 (33kD);cofactor required for Sp1 transcriptional activation, subunit 9, 33kDa;CRSP complex subunit 9;CRSP33;CRSP9;Mediator complex subunit 7;mediator of RNA polymerase II transcription subunit 7;RNA polymerase transcriptional regulation mediator subunit 7 homolog;transcriptional coactivator CRSP33
Weitere Details:: The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. Two transcript variants encoding the same protein have been found for this gene.

Versandbedingungen:: Blue Ice