A16088
MED7 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A16088
- Zusätzliche Namen:
- ARC34|CRSP33|CRSP9|MED7
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 27kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIEKDAALCVLIDEMNERP
- Uniprot:
- O43513
- Synonyme:
- activator-recruited cofactor 34 kDa component;ARC34;cofactor required for Sp1 transcriptional activation subunit 9;cofactor required for Sp1 transcriptional activation, subunit 9 (33kD);cofactor required for Sp1 transcriptional activation, subunit 9, 33kDa;CRSP complex subunit 9;CRSP33;CRSP9;Mediator complex subunit 7;mediator of RNA polymerase II transcription subunit 7;RNA polymerase transcriptional regulation mediator subunit 7 homolog;transcriptional coactivator CRSP33
- Weitere Details:
- The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. Two transcript variants encoding the same protein have been found for this gene.
- Versandbedingungen:
- Blue Ice

