SLC18A3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16068
Zusätzliche Namen:: CMS21|SLC18A3|VACHT
Anwendung:: ELISA, IHC-P, IF
Molekulargewicht:: 50 kDa(non-glycosylated), 70 kDa(glycosylated)
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GLLTRSRSERDVLLDEPPQGLYDAVRLRERPVSGQDGEPRSPPGPFDACEDDYNYYYTRS
Uniprot:: Q16572
Synonyme:: CMS21;solute carrier family 18 (vesicular acetylcholine transporter), member 3;solute carrier family 18 (vesicular acetylcholine), member 3;Solute carrier family 18 member 3;solute carrier family 18, member 3;VACHT;vesicular acetylcholine transporter
Weitere Details:: This gene is a member of the vesicular amine transporter family. The encoded transmembrane protein transports acetylcholine into secretory vesicles for release into the extracellular space. Acetylcholine transport utilizes a proton gradient established by a vacuolar ATPase. This gene is located within the first intron of the choline acetyltransferase gene.