MAP3K1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16057
Zusätzliche Namen:: MAP3K1|MAPKKK1|MEKK|MEKK 1|MEKK1|SRXY6
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 164kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVALRCLELQPQDRPPSRELLKHPVFRTTW
Uniprot:: Q13233
Synonyme:: MAP/ERK kinase kinase 1;MAPK/ERK kinase kinase 1;MAPKKK1;MEK kinase 1;MEKK;MEKK 1;MEKK1;mitogen-activated protein kinase kinase kinase 1;mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase;SRXY6
Weitere Details:: The protein encoded by this gene is a serine/threonine kinase and is part of some signal transduction cascades, including the ERK and JNK kinase pathways as well as the NF-kappa-B pathway. The encoded protein is activated by autophosphorylation and requires magnesium as a cofactor in phosphorylating other proteins. This protein has E3 ligase activity conferred by a plant homeodomain (PHD) in its N-terminus and phospho-kinase activity conferred by a kinase domain in its C-terminus.