A16046
FBLN1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A16046
- Zusätzliche Namen:
- FBLN|FBLN1|FIBL1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 77kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- RLPCHENRECSKLPLRITYYHLSFPTNIQAPAVVFRMGPSSAVPGDSMQLAITGGNEEGFFTTRKVSPHSGVVALTKPVPEPRDLLLTVKMDLSRHGTVSS
- Uniprot:
- P23142
- Synonyme:
- FBLN;FIBL1;fibulin-1
- Weitere Details:
- Fibulin 1 is a secreted glycoprotein that becomes incorporated into a fibrillar extracellular matrix. Calcium-binding is apparently required to mediate its binding to laminin and nidogen. It mediates platelet adhesion via binding fibrinogen. Four splice variants which differ in the 3' end have been identified. Each variant encodes a different isoform, but no functional distinctions have been identified among the four variants.
- Versandbedingungen:
- Blue Ice


_WB_01.jpg)
_WB_02.jpg)