DCT Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16041
Zusätzliche Namen:: DCT|OCA8|TRP-2|TYRP2
Anwendung:: ELISA, WB
Molekulargewicht:: 59kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: NVCGSQQGRGQCTEVRADTRPWSGPYILRNQDDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITTQHWLGLLGPNGTQPQFANCSVYDFFVWLHYYSVRDTLLGPGRPYRAIDFSHQGPAFVTWHRYHLLCLERDLQRLIGNESFALPYWNFATGRNECDVCTDQLFGAARPDDPTLISRNSRFSSWETVCDSLDDYNHLVTLCNGTYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKFDNPPFFQNSTFSFRNA
Uniprot:: P40126
Synonyme:: dopachrome delta-isomerase;dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2);DT;L-dopachrome Delta-isomerase;L-dopachrome isomerase;L-dopachrome tautomerase;OCA8;TRP-2;TRP2;tyrosinase related protein-2;Tyrosinase-related protein 2;tyrosine-related protein 2;TYRP2
Weitere Details:: Predicted to enable dopachrome isomerase activity. Involved in response to blue light. Located in intracellular membrane-bounded organelle and plasma membrane. Implicated in oculocutaneous albinism.