Zip12 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16006
Zusätzliche Namen:: bA570F3.1|LZT-Hs8|ZIP-12|ZIP12
Anwendung:: ELISA, WB
Molekulargewicht:: 77kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Sequenz:: MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVLSAGDHPPHNHSRSLIKTLLEKTGCPRRRNGMQGDCNLCFEPDALLLIAGG
Uniprot:: Q504Y0
Synonyme:: bA570F3.1;LIV-1 subfamily of ZIP zinc transporter 8;LZT-Hs8;solute carrier family 39 (metal ion transporter), member 12;solute carrier family 39 (zinc transporter), member 12;Solute carrier family 39 member 12;zinc transporter ZIP12;ZIP-12;ZIP12;zrt- and Irt-like protein 12
Weitere Details:: Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A12 belongs to a subfamily of proteins that show structural characteristics of zinc transporters (Taylor and Nicholson, 2003 [PubMed 12659941]).