SULT1A1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A1599
Zusätzliche Namen:: HAST1/HAST2|P-PST|P-PST 1|PST|ST1A1|ST1A3|STP|STP1|SULT1A1|ts-PST|TSPST1
Anwendung:: ELISA, WB
Molekulargewicht:: 34kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Uniprot:: P50225
Synonyme:: aryl sulfotransferase 1;HAST1/HAST2;P-PST;P-PST 1;Phenol sulfotransferase 1;phenol-sulfating phenol sulfotransferase 1;PST;ST1A1;ST1A3;STP;STP1;sulfotransferase 1A1;sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1;Thermostable phenol sulfotransferase;thermostable phenol sulfotransferase1;ts-PST;TSPST1
Weitere Details:: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes one of two phenol sulfotransferases with thermostable enzyme activity. Multiple alternatively spliced variants that encode two isoforms have been identified for this gene.

Versandbedingungen:: Blue Ice