A15964
ZNF384 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A15964
- Zusätzliche Namen:
- CAGH1|CAGH1A|CIZ|ERDA2|NMP4|NP|TNRC1|ZNF384
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 70 kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MEESHFNSNPYFWPSIPTVSGQIENTMFINKMKDQLLPEKGCGLAPPHYPTLLTVPASVSLPSGISMDTESKSDQLTPHS
- Uniprot:
- Q8TF68
- Synonyme:
- CAG repeat protein 1;CAGH1;CAGH1A;Cas-interacting zinc finger protein;CIZ;ERDA2;expanded repeat domain, CAG/CTG 2;NMP4;NP;nuclear matrix transcription factor 4;TNRC1;trinucleotide repeat-containing gene 1 protein;zinc finger protein 384
- Weitere Details:
- This gene encodes a C2H2-type zinc finger protein, which may function as a transcription factor. This gene also contains long CAG trinucleotide repeats that encode consecutive glutamine residues. The protein appears to bind and regulate the promoters of the extracellular matrix genes MMP1, MMP3, MMP7 and COL1A1. Studies in mouse suggest that nuclear matrix transcription factors (NP/NMP4) may be part of a general mechanical pathway that couples cell construction and function during extracellular matrix remodeling. Alternative splicing results in multiple transcript variants. Recurrent rearrangements of this gene with the Ewing's sarcoma gene, EWSR1 on chromosome 22, or with the TAF15 gene on chromosome 17, or with the TCF3 (E2A) gene on chromosome 19, have been observed in acute leukemia. A related pseudogene has been identified on chromosome 7.
- Versandbedingungen:
- Blue Ice








