A15961
HSCB Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A15961
- Zusätzliche Namen:
- DNAJC20|HSC20|HSCB|JAC1|SIDBA5
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 27kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- AASQAGSNYPRCWNCGGPWGPGREDRFFCPQCRALQAPDPTRDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKKIPL
- Uniprot:
- Q8IWL3
- Synonyme:
- DnaJ (Hsp40) homolog, subfamily C, member 20;DnaJ homolog subfamily C member 20;DNAJC20;epididymis secretory sperm binding protein;HSC20;HscB iron-sulfur cluster co-chaperone homolog;HscB mitochondrial iron-sulfur cluster co-chaperone;iron-sulfur cluster co-chaperone protein HscB;iron-sulfur cluster co-chaperone protein HscB, mitochondrial;J-type co-chaperone HSC20;JAC1;SIDBA5
- Weitere Details:
- This gene encodes a DnaJ-type co-chaperone and member of the heat shock cognate B (HscB) family of proteins. The encoded protein plays a role in the synthesis of iron-sulfur clusters, protein cofactors that are involved in the redox reactions of mitochondrial electron transport and other processes. Cells in which this gene is knocked down exhibit reduced activity of iron-sulfur cluster-dependent enzymes including succinate dehydrogenase and aconitase. The encoded protein may stimulate the ATPase activity of the mitochondrial stress-70 protein. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice

