CHCHD1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15941
Zusätzliche Namen:: C10orf34|C2360|CHCHD1|MRP-S37
Anwendung:: ELISA, WB
Molekulargewicht:: 13kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMSVMMACWKQNEFRDDACRKEIQGFLDCAARAQEARKMRSIQETLGESGSLLPNKLNKLLQRFPNKPYLS
Uniprot:: Q96BP2
Synonyme:: 28S ribosomal protein S37, mitochondrial;C10orf34;C2360;coiled-coil-helix-coiled-coil-helix domain-containing protein 1;mitochondrial small ribosomal subunit protein mS37;MRP-S37;nuclear protein C2360
Weitere Details:: Enables RNA binding activity. Predicted to be involved in mitochondrial translation. Located in cytosol; mitochondrion; and nuclear lumen.