A1593
Bad Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A1593
- Zusätzliche Namen:
- Bad|BBC2|BCL2L8
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 15kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- HQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRV
- Uniprot:
- Q92934
- Synonyme:
- BBC2;bcl-2-binding component 6;bcl-2-like protein 8;BCL-X/BCL-2 binding protein;bcl-XL/Bcl-2-associated death promoter;bcl2 antagonist of cell death;BCL2-antagonist of cell death protein;bcl2-associated agonist of cell death;BCL2-binding component 6;BCL2-binding protein;bcl2-L-8;BCL2L8
- Weitere Details:
- The protein encoded by this gene is a member of the BCL-2 family. BCL-2 family members are known to be regulators of programmed cell death. This protein positively regulates cell apoptosis by forming heterodimers with BCL-xL (B-cell lymphoma-extra large) and BCL-2, and reversing their death repressor activity. Proapoptotic activity of this protein is regulated through its phosphorylation. Protein kinases AKT and MAP kinase, as well as protein phosphatase calcineurin were found to be involved in the regulation of this protein. Alternative splicing of this gene results in two transcript variants which encode the same isoform.
- Versandbedingungen:
- Blue Ice





