CYB5B Rabbit polyclonal antibody

Größe

£152.00

SKU:: A15900
Zusätzliche Namen:: CYB5-M|CYB5B|CYPB5M|OMB5
Anwendung:: ELISA, WB
Molekulargewicht:: 20kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSCWAYWILPIIGAVLLGFLYRYYTSESKSS
Uniprot:: O43169
Synonyme:: CYB5-M;CYPB5M;Cytochrome b5 outer mitochondrial membrane isoform;cytochrome b5 type B;cytochrome b5 type B (outer mitochondrial membrane);OMB5;outer mitochondrial membrane cytochrome b5;type 2 cyt-b5
Weitere Details:: Enables heme binding activity. Contributes to nitrite reductase (NO-forming) activity. Involved in nitric oxide biosynthetic process. Located in membrane. Part of nitric-oxide synthase complex.