A15892
DDX31 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A15892
- Zusätzliche Namen:
- DDX31|PPP1R25
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 94 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- EIKMEDILCVLTRDDCFKGKRWGAQKSHAVGPQEIRERATVLQTVFEDYVHSSERRVSWAKKALQSFIQAYATYPRELKHIFHVRSLHLGHVAKSFGLRDAPRNLSALTRKKRKAHVKRPDLHKKTQSKHSLAEILRSEYSSGMEADIAKVKKQNAPGEPGGRPLQHSLQPTPCFGRGKTLKWRKTQKGVQRDSKTSQKV
- Uniprot:
- Q9H8H2
- Synonyme:
- DEAD (Asp-Glu-Ala-Asp) box polypeptide 31;DEAD box protein 31;DEAD/DEXH helicase DDX31;DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 31;G2 helicase;helicain;PPP1R25;probable ATP-dependent RNA helicase DDX31;protein phosphatase 1, regulatory subunit 25
- Weitere Details:
- DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates multiple transcript variants encoding different isoforms.
- Versandbedingungen:
- Blue Ice